Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR7A10 Olfactory Receptor

Gene Symbol OR7A101 (View this gene in GeneCards)
Family 7
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR19-18, CIT-HSP-146e8, OST027, HsOR19.3.3, ORL3773
External Ids HGNC: 8356   GeneBank: AF399542, BK004222, NM_001005190   ORDB: ORL3773   
Build #39 labels OR7A10
Chromosomal location 19:14,840,951-14,841,877 (-)
Cluster 19@15a
Synteny CLIC#45
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR7A17 82.52% 309
OR7A2P 80.58% 309
OR7A8P 81.23% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR7A74 77% 308
Chimp CONTIG1211.24-5657 97% 309
Mouse Or7a36 75% 308
Rat Or7a41 77% 303
Cow OR7A65 78% 308
Cow OR7A10 81% 306
Cow OR7A10B 80% 306

Expression evidences

Source Accession
GNF Atlas2 217316_at

Sequence information

Nucleotide sequence ATGAAATCATGGAACAATACAATAATTTTAGAATTTCTTCTCCTGGGAATTTCAGAGGAA
CCAGAATTGCAGGCCTTCCTCTTTGGGCTGTTCCTGTCCATGTACCTGGTCACTGTGCTC
GGGAACCTGCTCATCATCCTGGCCACAATCTCAGACTCCCACCTCCACACCCCCATGTAC
TTCTTCCTCTCCAACCTGTCCTTCGTAGACATCTGTTTTGTCTCTACCACTGTCCCGAAG
ATGCTGGTGAACATCCAGACACACAACAAAGTCATCACCTATGCAGGCTGCATCACCCAG
ATGTGCTTTTTCTTACTCTTTGTAGGATTGGATAACTTCCTTCTGACCGTGATGGCCTAT
GACCGGTTTGTGGCCATCTGTCACCCTCTGCACTACATGGTCATTATGAACCCTCAACTC
TGTGGACTGCTGGTTCTGGCATCCTGGATCATGAGTGTTCTGAATTCCATGTTACAAAGC
TTAATGGTGTTGCCACTGCCCTTTTGTACACACATGGAAATCCCTCATTTTTTCTGTGAA
ATTAATCAGGTGGTCCACCTTGCCTGTTCTGACACCTTTCTTAATGACATAGTGATGTAT
TTTGCAGTAGCGCTGCTGGGCGGTGGTCCCCTCACTGGGATCCTGTACTCTTACTCTAAG
ATAGTTTCCTCCATACGTGCAATCTCATCAGCTCAGGGGAAGTATAAGGCATTTTCCACC
TGTGCATCTCACCTCTCAGTTGTCTCCTTATTTTATGGTACATGCTTAGGGGTGTACCTT
AGTTCTGCTGCCACCCACAATTCACACACAGGTGCTGCAGCCTCAGTGATGTACACTGTG
GTCACCCCCATGCTGAACCCCTTCATCTACAGTCTGAGGAATAAACACATAAAGGGTGCT
ATGAAAACATTCTTCAGAGGAAAGCAA
Conceptual translation MKSWNNTIILEFLLLGISEEPELQAFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMY
FFLSNLSFVDICFVSTTVPKMLVNIQTHNKVITYAGCITQMCFFLLFVGLDNFLLTVMAY
DRFVAICHPLHYMVIMNPQLCGLLVLASWIMSVLNSMLQSLMVLPLPFCTHMEIPHFFCE
INQVVHLACSDTFLNDIVMYFAVALLGGGPLTGILYSYSKIVSSIRAISSAQGKYKAFST
CASHLSVVSLFYGTCLGVYLSSAATHNSHTGAAASVMYTVVTPMLNPFIYSLRNKHIKGA
MKTFFRGKQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 14,952,583 14,952,583 NS A/G L/P rs28540032 (DbSNP)
19 14,952,238 14,952,238 NS A/G M/T rs12972670 (DbSNP)
19 14,952,017 14,952,017 NS A/T L/I rs11880955 (DbSNP)
19 14,952,143 14,952,143 NS C/G E/Q rs9305052 (DbSNP)
19 14,951,873 14,951,873 NS C/T A/T rs10221530 (DbSNP)
19 14,952,560 14,952,560 NS G/T L/I rs12985894 (DbSNP)
19 14,951,889 14,951,889 SYN A/G N/N rs3752194 (DbSNP)
19 14,951,898 14,951,898 SYN G/T A/A rs3752195 (DbSNP)
19 14,841,086 14,841,086 SYN G/T A/A 1000GP (CEU, CHBJPT)
19 14,841,077 14,841,077 SYN A/G N/N 1000GP (CEU, CHBJPT)
19 14,841,426 14,841,426 NS A/G M/T 1000GP (CEU, CHBJPT)
19 100 -100 SYN A/G N/N 1000GP (YRI, YRI, YRI)
19 100 -100 NS G/C Q/E 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 183 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Y290C H266R V247D I225L Y216F Q183E M151T S67C L36P % Freq CORP
1 Y H V I Y Q M S L 81.95 0.078
2 Y H V L Y Q T S L 12.21 0.078
3 Y H V I Y E M S L 2.92 0.078
4 Y H V L Y Q M S P 1.77 0.078
5 Y R V I Y Q M S L 0.31 0.078
6 Y H V L Y Q M S L 0.23 0.078
7 Y H V I Y Q M S P 0.15 0.078
8 C R V I Y Q M S L 0.15 0.078
9 Y H V I Y E M C L 0.08 0.006
10 Y H D I Y Q M S L 0.08 0.098
11 Y H V I F Q M S L 0.08 0.078
12 Y H V L Y Q T S P 0.08 0.078

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR7A10.aApr07-unspliced main_exon 3UTR chr19 14,840,948 14,840,951 -
CDS chr19 14,840,951 14,841,877 -