Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR9I2P Olfactory Receptor

Gene Symbol OR9I2P1 (View this gene in GeneCards)
Family 9
Subfamily I
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-229, HsOR11.12.6P, ORL3443
External Ids HGNC: 15324   GeneBank: AF179762, AY284293-AY284324, BK004563, NG_002279   ORDB: ORL3443   
Build #39 labels OR9I2P
Chromosomal location 11:58,144,426-58,145,421 (+)
Cluster 11@58
Synteny CLIC#27
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR9I1 60.26% 307
OR9Q1 53.67% 313
OR9Q2 55.66% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR9I2 80% 327
Chimp CONTIG49149.1-217 89% 227
Mouse Or9i2 78% 313
Rat Or9i2 77% 313
Cow OR9I2 77% 327

Sequence information

Nucleotide sequence TTAATGAGACTTTATTATTATTATTTTTTAATTTCAGTGGATAACGTTGGCTTCATGGCA
GAGAGTGGCACCACGGTGACAGAATTTTTTCTGAGGGGGTTCCGGTTGAAGGCAGAGCTG
CAGATAGGTCTCTTCTTTGTGTTTCTGGTCATTTTTCTCATCACCATGGGGGGCAACCTG
GGCATGATTGTGCTAATTTAATTCAGACTGACCCTCGGCTCCAGACTCCCATGTACTTCT
TCCTCAGTCATCTTTCCTTCCTGGACATTTGCTACTCTTCTGTTATTGGTCCTCAGTTGC
TTGAGACTTTGGGACTGATAAGATGATCATCACCTATGAGCGCTGTGCCAGCCAATTCTT
CTTTTTCACACTCTGTGCTAGCATTGAGTGTTTCCTTTTGGCTGTGATGGCTTATGACCG
GTACGTGGCTGTGTGTAACCCCCTCCTCTATGCCATAGTCATGACACCAAAGACCCGCCT
GGCGCTGCTGGCCGGGGCATATTCTGGTGCCATAGTCAATTCTGTGATCTGCACTGGCTG
CACCTTCTCTATCTCCTTCTCTAAGTCCAACCATGTAGACTTCTTTTTCTGTGACCTCCC
ACCCCTGCTGAAGCTTGCCTGTAGTGAAACCAGGCCACGGGAATGGGTAATCTACCTCTC
AGCTTTTCTGGTCATCACAACCAGCATTTCAGTGATTCTTACATCGTACTTGTTCATCAT
TCAGTCTGTTCTGAAGATTCGTACAGCAGGTGGAAAGCCAAGACCTTCTCCACCTGTGCT
TCTCACATGACTGCATTGACTCTCTTCTTTGGAACACTCATATTCATATACCTGAAAGGC
AACATGGGCGAATCCCTTGAGGAAGACAAGATCGTGTCAATATTTTACACTGTGGTCATC
CCCATGCTAAATCCAATGATCTACAGCCTGAGAAACAAAGACATGAAAGAGGCTCTGAAG
AAAGTTTTCAACAGGATAAGGGTTTCCCAAGCAGAG
Conceptual translation LMRLYYYYFLISVDNVGFMAESGTTVTEFFLRGFRLKAELQIGLFFVFLVIFLITMGGNL
GMIVL/LIQTDPRLQTPMYFFLSHLSFLDICYSSVIGPQLL/DFGTDKMIITYERCAS
QFFFFTLCASIECFLLAVMAYDRYVAVCNPLLYAIVMTPKTRLALLAGAYSGAIVNSVIC
TGCTFSISFSKSNHVDFFFCDLPPLLKLACSETRPREWVIYLSAFLVITTSISVILTSYL
FIIQSVLKIRTAGG/AKTFSTCASHMTALTLFFGTLIFIYLKGNMGESLEEDKIVSIFY
TVVIPMLNPMIYSLRNKDMKEALKKVFNRIRVSQAE

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
11 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
11 57,911,908 57,911,909 Del(2) -/TT rs35928418 (DbSNP)
11 57,911,911 57,911,911 Del(1) -/A rs34943687 (DbSNP)
11 57,911,919 57,911,921 In-Del(3) -/AAT rs71847766 (DbSNP)
11 57,911,920 57,911,920 SNP A/T rs67778194 (DbSNP)
11 57,911,920 57,911,922 In-Del(3) -/AAT rs67778193 (DbSNP)
11 57,912,292 57,912,292 Del(1) -/C rs59033801 (DbSNP)
11 57,912,366 57,912,365 Ins(1) -/A rs34531982 (DbSNP)
11 57,912,539 57,912,538 Ins(1) -/A rs35546731 (DbSNP)
11 57,912,625 57,912,625 SNP G/A rs2443433 (DbSNP)
11 57,912,638 57,912,638 SNP A/G rs7945154 (DbSNP)
11 57,912,650 57,912,650 SNP A/G rs2441983 (DbSNP)
11 57,912,693 57,912,693 SNP G/T rs2245676 (DbSNP)
11 57,912,766 57,912,766 SNP A/G rs12577581 (DbSNP)
11 58,144,819 58,144,819 SNP C/T 1000GP (CEU)
11 58,145,050 58,145,050 SNP T/A 1000GP (CEU)
11 58,145,128 58,145,128 SNP A/G 1000GP (CEU)
11 58,145,153 58,145,153 SNP G/A 1000GP (CEU, CHBJPT)
11 58,145,166 58,145,166 SNP G/A 1000GP (CEU, CHBJPT)
11 58,145,178 58,145,178 SNP G/A 1000GP (CEU, CHBJPT)
11 58,145,221 58,145,221 SNP T/G 1000GP (CEU, CHBJPT)
11 58,145,294 58,145,294 SNP A/G 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 172 (Hasin)
11 57,912,509 57,948,750 CopyNumber Variation_4745 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.